PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G212900.1.p
Common NameLOC101769551, SETIT_010077mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 453aa    MW: 49797.9 Da    PI: 8.4626
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G212900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-1659103147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT++E++l+++a +q+G   W++I +++g  +t+ q++s+ qk+
  Seita.7G212900.1.p  59 REKWTEDEHKLFLEALQQHGRA-WRRIQEHIG-SKTAVQIRSHAQKF 103
                         789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.64E-1453106IPR009057Homeodomain-like
PROSITE profilePS5129419.77554108IPR017930Myb domain
TIGRFAMsTIGR015575.4E-1557106IPR006447Myb domain, plants
SMARTSM007171.1E-1258106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-959101IPR009057Homeodomain-like
PfamPF002494.3E-1459102IPR001005SANT/Myb domain
CDDcd001673.46E-1061104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MARFQEIKAR NDQRPSADRV GHGNFMDHLK NTLNSGAMDL PEGARAPKAR KPYTISKLRE  60
KWTEDEHKLF LEALQQHGRA WRRIQEHIGS KTAVQIRSHA QKFFSKVIRE SSGDSNSIAA  120
PPQIQIPPPR PKRKPSHPYP RKLGNSLRKD ASTIKQLEKP LLKIQPLFEQ ENCSPKSVLT  180
TAQIGSEILA LEGSGSPASS VYMEEKCLTP STSVGELGVQ VARSKDATTS DGAACGMPEG  240
PVLRLFGKRV VVNNLHQQQN SNTGDLQHVA DMELDTSAET PTSGTGKFSS HGAEEAKTWS  300
PWLTGTQQLM YYLPQGEVLS VHSACQFLSY GNGSISYRVL NPQTVTSDKQ QHQPSEAADC  360
KFTRAEGSWT ESITTSNNVP ETAPQNSDSI ESTQVNNNED EVIPVPGSRK YSTVPAYLRG  420
FVPYKKCAAQ SKMLQSWVPG EEADGEMTRL CL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976600.10.0PREDICTED: myb-like protein J
TrEMBLK3Y7860.0K3Y786_SETIT; Uncharacterized protein
STRINGSi010077m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27223686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.15e-38MYB_related family protein